Made in USA1 / 2Peptides
LL-37 5mg
A human cathelicidin-derived antimicrobial peptide studied in preclinical research for its effects on innate immune and antimicrobial signaling.
- CAS Number
- 154947-66-7
- Published Research
- View studies →
$70.00
When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your lot.
For laboratory research use only. Not for human consumption.
Technical Information
- CAS Number
- 154947-66-7
- Molecular Formula
- C205H340N60O53
- Molar Mass
- 4493.4 g/mol
- Sequence
- [LL-37, 37 aa]
- Synonyms
- Human cathelicidin, CAP-18 (109-140)
- Form
- Lyophilized powder
- Container
- Sealed glass vial, flip-top cap
- State
- Not reconstituted
- Purity
- Verified per lot on the Certificate of Analysis
Batch Testing
Every lot is tested and documented. When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your exact lot.
Frequently asked questions
- How is the purity of each lot verified?
- Every lot of LL-37 5mg we sell has a lot-specific Certificate of Analysis (COA) verifying identity and purity for that batch. A digital copy is sent with your tracking when your order ships.
- What comes with an order?
- Each order includes the product as listed, packaged for laboratory use, along with access to that lot's Certificate of Analysis. No dosing instructions, administration guidance, or human-use directions are provided with any order.
- Who can purchase from Vitality Certified Peptides?
- Qualified researchers of every kind, including independent researchers, who are at least 21 years of age. You do not need to represent a lab or institution; every purchase is for laboratory research use only, in compliance with applicable federal, state, and local law.
Related compounds