Made in USA1 / 2Peptides
TB-500 10mg
A synthetic peptide corresponding to the active region of thymosin beta-4, studied in preclinical research for effects on cell migration and tissue repair processes.
- CAS Number
- 885340-08-9
- Published Research
- View studies →
$70.00
When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your lot.
For laboratory research use only. Not for human consumption.
Technical Information
- CAS Number
- 885340-08-9
- Molecular Formula
- C212H350N56O78S
- Molar Mass
- 4963.4 g/mol
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Synonyms
- Thymosin Beta-4, TB4
- Form
- Lyophilized powder
- Container
- Sealed glass vial, flip-top cap
- State
- Not reconstituted
- Purity
- Verified per lot on the Certificate of Analysis
Batch Testing
Every lot is tested and documented. When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your exact lot.
Frequently asked questions
- How is the purity of each lot verified?
- Every lot of TB-500 10mg we sell has a lot-specific Certificate of Analysis (COA) verifying identity and purity for that batch. A digital copy is sent with your tracking when your order ships.
- What comes with an order?
- Each order includes the product as listed, packaged for laboratory use, along with access to that lot's Certificate of Analysis. No dosing instructions, administration guidance, or human-use directions are provided with any order.
- Who can purchase from Vitality Certified Peptides?
- Qualified researchers of every kind, including independent researchers, who are at least 21 years of age. You do not need to represent a lab or institution; every purchase is for laboratory research use only, in compliance with applicable federal, state, and local law.
Related compounds