TB-500 10mgMade in USA1 / 2

Peptides

TB-500 10mg

A synthetic peptide corresponding to the active region of thymosin beta-4, studied in preclinical research for effects on cell migration and tissue repair processes.

CAS Number
885340-08-9
Published Research
View studies →

$70.00

When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your lot.

For laboratory research use only. Not for human consumption.

Technical Information

CAS Number
885340-08-9
Molecular Formula
C212H350N56O78S
Molar Mass
4963.4 g/mol
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Synonyms
Thymosin Beta-4, TB4
Form
Lyophilized powder
Container
Sealed glass vial, flip-top cap
State
Not reconstituted
Purity
Verified per lot on the Certificate of Analysis

Batch Testing

Every lot is tested and documented. When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your exact lot.

Frequently asked questions

How is the purity of each lot verified?
Every lot of TB-500 10mg we sell has a lot-specific Certificate of Analysis (COA) verifying identity and purity for that batch. A digital copy is sent with your tracking when your order ships.
What comes with an order?
Each order includes the product as listed, packaged for laboratory use, along with access to that lot's Certificate of Analysis. No dosing instructions, administration guidance, or human-use directions are provided with any order.
Who can purchase from Vitality Certified Peptides?
Qualified researchers of every kind, including independent researchers, who are at least 21 years of age. You do not need to represent a lab or institution; every purchase is for laboratory research use only, in compliance with applicable federal, state, and local law.

Related compounds

Also studied in Tissue & Inflammation Research

View all Tissue & Inflammation Research