VIP 5mgMade in USA1 / 2

Peptides

VIP 5mg

Synthetic 28-amino-acid, C-terminally amidated peptide (Vasoactive Intestinal Peptide) naturally occurring in the human body; studied for smooth-muscle, secretory, immune, and neuroendocrine signaling research.

CAS Number
40077-57-4
Published Research
View studies →

$39.00

When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your lot.

For laboratory research use only. Not for human consumption.

Technical Information

CAS Number
40077-57-4
Molecular Formula
C147H238N44O42S
Molar Mass
3325.8 g/mol
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Synonyms
Vasoactive intestinal peptide
Form
Lyophilized powder
Container
Sealed glass vial, flip-top cap
State
Not reconstituted
Purity
Verified per lot on the Certificate of Analysis

Batch Testing

Every lot is tested and documented. When your order ships you receive tracking and a digital copy of the Certificate of Analysis for your exact lot.

Frequently asked questions

How is the purity of each lot verified?
Every lot of VIP 5mg we sell has a lot-specific Certificate of Analysis (COA) verifying identity and purity for that batch. A digital copy is sent with your tracking when your order ships.
What comes with an order?
Each order includes the product as listed, packaged for laboratory use, along with access to that lot's Certificate of Analysis. No dosing instructions, administration guidance, or human-use directions are provided with any order.
Who can purchase from Vitality Certified Peptides?
Qualified researchers of every kind, including independent researchers, who are at least 21 years of age. You do not need to represent a lab or institution; every purchase is for laboratory research use only, in compliance with applicable federal, state, and local law.